Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.2: Colicin E3 immunity protein [54552] (1 family) automatically mapped to Pfam PF03513 |
Family d.26.2.1: Colicin E3 immunity protein [54553] (1 protein) |
Protein Colicin E3 immunity protein [54554] (2 species) |
Species Escherichia coli [TaxId:469008] [280470] (1 PDB entry) |
Domain d4udma_: 4udm A: [280471] Other proteins in same PDB: d4udmb_ automated match to d1e44a_ complexed with ca, cl; mutant |
PDB Entry: 4udm (more details), 2.96 Å
SCOPe Domain Sequences for d4udma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4udma_ d.26.2.1 (A:) Colicin E3 immunity protein {Escherichia coli [TaxId: 469008]} glkldltwfdkstedfkgeeyskdfgddgsvmeslgvpfkdnvnngcfdviaewvpllqp yfnhqidisdneyfvsfdyrdgdw
Timeline for d4udma_: