Lineage for d4udma_ (4udm A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941852Superfamily d.26.2: Colicin E3 immunity protein [54552] (1 family) (S)
    automatically mapped to Pfam PF03513
  5. 2941853Family d.26.2.1: Colicin E3 immunity protein [54553] (1 protein)
  6. 2941854Protein Colicin E3 immunity protein [54554] (2 species)
  7. 2941855Species Escherichia coli [TaxId:469008] [280470] (1 PDB entry)
  8. 2941856Domain d4udma_: 4udm A: [280471]
    Other proteins in same PDB: d4udmb_
    automated match to d1e44a_
    complexed with ca, cl; mutant

Details for d4udma_

PDB Entry: 4udm (more details), 2.96 Å

PDB Description: crystal structure of im3 in complex with y52a mutant of e3rnase
PDB Compounds: (A:) colicin-e3 immunity protein

SCOPe Domain Sequences for d4udma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4udma_ d.26.2.1 (A:) Colicin E3 immunity protein {Escherichia coli [TaxId: 469008]}
glkldltwfdkstedfkgeeyskdfgddgsvmeslgvpfkdnvnngcfdviaewvpllqp
yfnhqidisdneyfvsfdyrdgdw

SCOPe Domain Coordinates for d4udma_:

Click to download the PDB-style file with coordinates for d4udma_.
(The format of our PDB-style files is described here.)

Timeline for d4udma_: