SCOPe 2.08: Domain d4udmb_: 4udm B:

Lineage for d4udmb_ (4udm B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.101: Ribonuclease domain of colicin E3 [63839] (1 superfamily)
   twisted meander beta-sheet of 6 strands

4. Superfamily b.101.1: Ribonuclease domain of colicin E3 [63840] (1 family)
   automatically mapped to Pfam PF09000

5. Family b.101.1.1: Ribonuclease domain of colicin E3 [63841] (2 proteins)

6. Protein automated matches [280467] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:469008] [280468] (1 PDB entry)

8. Domain d4udmb_: 4udm B: [280469]
   Other proteins in same PDB: d4udma_
   automated match to d1e44b_
   complexed with ca, cl; mutant

Details for d4udmb_

PDB Entry: 4udm, 2.96 Å

PDB Description: crystal structure of im3 in complex with y52a mutant of e3rnase

PDB Compounds: (B:) Colicin-E3

SCOPe Domain Sequences for d4udmb_:

Sequence; same for both SEQRES and ATOM records:

>d4udmb_ b.101.1.1 (B:) automated matches {Escherichia coli [TaxId: 469008]}
gfkdyghdyhpapktenikglgdlkpgipktpkqngggkrkrwtgdkgrkiaewdsqhge
legyrasdgqhlgsfdpktgnqlkgpdpkrnikkyl

Timeline for d4udmb_:

• d4udmb_ first appeared in SCOPe 2.05
  
• d4udmb_ appears in SCOPe 2.07