Lineage for d4obta_ (4obt A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1815293Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 1815651Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 1815652Protein automated matches [190605] (17 species)
    not a true protein
  7. Species Arabidopsis thaliana [TaxId:3702] [268515] (2 PDB entries)
  8. 1815654Domain d4obta_: 4obt A: [280464]
    automated match to d1tmha_

Details for d4obta_

PDB Entry: 4obt (more details), 1.6 Å

PDB Description: crystal structure of arabidopsis thaliana cytosolic triose phosphate isomerase
PDB Compounds: (A:) Triosephosphate isomerase, cytosolic

SCOPe Domain Sequences for d4obta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4obta_ c.1.1.0 (A:) automated matches {Arabidopsis thaliana [TaxId: 3702]}
arkffvggnwkcngtaeevkkivntlneaqvpsqdvvevvvsppyvflplvkstlrsdff
vaaqncwvkkggaftgevsaemlvnldipwvilghserrailnessefvgdkvayalaqg
lkviacvgetleereagstmdvvaaqtkaiadrvtnwsnvviayepvwaigtgkvaspaq
aqevhdelrkwlaknvsadvaattriiyggsvnggnckelggqadvdgflvggaslkpef
idiikaaevk

SCOPe Domain Coordinates for d4obta_:

Click to download the PDB-style file with coordinates for d4obta_.
(The format of our PDB-style files is described here.)

Timeline for d4obta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4obtb_