Lineage for d4obtb1 (4obt B:3-251)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2413228Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2413631Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 2413632Protein automated matches [190605] (21 species)
    not a true protein
  7. 2413738Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [268515] (2 PDB entries)
  8. 2413740Domain d4obtb1: 4obt B:3-251 [280463]
    Other proteins in same PDB: d4obta2, d4obtb2
    automated match to d1tmha_

Details for d4obtb1

PDB Entry: 4obt (more details), 1.6 Å

PDB Description: crystal structure of arabidopsis thaliana cytosolic triose phosphate isomerase
PDB Compounds: (B:) Triosephosphate isomerase, cytosolic

SCOPe Domain Sequences for d4obtb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4obtb1 c.1.1.0 (B:3-251) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rkffvggnwkcngtaeevkkivntlneaqvpsqdvvevvvsppyvflplvkstlrsdffv
aaqncwvkkggaftgevsaemlvnldipwvilghserrailnessefvgdkvayalaqgl
kviacvgetleereagstmdvvaaqtkaiadrvtnwsnvviayepvwaigtgkvaspaqa
qevhdelrkwlaknvsadvaattriiyggsvnggnckelggqadvdgflvggaslkpefi
diikaaevk

SCOPe Domain Coordinates for d4obtb1:

Click to download the PDB-style file with coordinates for d4obtb1.
(The format of our PDB-style files is described here.)

Timeline for d4obtb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4obtb2