Lineage for d5hava_ (5hav A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 2301126Protein Myoglobin [46469] (10 species)
  7. 2301271Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (282 PDB entries)
    Uniprot P02185
  8. 2301341Domain d5hava_: 5hav A: [280461]
    automated match to d4fwya_
    complexed with hem, oxy; mutant

Details for d5hava_

PDB Entry: 5hav (more details), 1.27 Å

PDB Description: sperm whale myoglobin mutant l29h f33y f43h (f33y cubmb) with oxygen bound
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d5hava_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hava_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdihirlykshpetlekhdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d5hava_:

Click to download the PDB-style file with coordinates for d5hava_.
(The format of our PDB-style files is described here.)

Timeline for d5hava_: