Lineage for d5fr1a_ (5fr1 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1849617Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1849618Protein automated matches [190123] (96 species)
    not a true protein
  7. 1849890Species Human (Homo sapiens) [TaxId:9606] [186862] (102 PDB entries)
  8. 1850064Domain d5fr1a_: 5fr1 A: [280460]
    Other proteins in same PDB: d5fr1b_
    automated match to d2dfkd_
    complexed with gdp, mg

Details for d5fr1a_

PDB Entry: 5fr1 (more details), 2.75 Å

PDB Description: double acetylated rhogdi-alpha in complex with rhoa-gdp
PDB Compounds: (A:) transforming protein rhoa

SCOPe Domain Sequences for d5fr1a_:

Sequence, based on SEQRES records: (download)

>d5fr1a_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
irkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtagq
edydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlrn
dehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqarr
gkkksgclvl

Sequence, based on observed residues (ATOM records): (download)

>d5fr1a_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
irkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtagq
edydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlrn
dehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqasg
clvl

SCOPe Domain Coordinates for d5fr1a_:

Click to download the PDB-style file with coordinates for d5fr1a_.
(The format of our PDB-style files is described here.)

Timeline for d5fr1a_: