SCOPe 2.05: Domain d5fr1b_: 5fr1 B:

Lineage for d5fr1b_ (5fr1 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.8: RhoGDI-like [81288] (3 proteins)

6. Protein automated matches [190534] (2 species)
   not a true protein

7. Species Bos taurus [TaxId:9913] [280458] (1 PDB entry)

8. Domain d5fr1b_: 5fr1 B: [280459]
   Other proteins in same PDB: d5fr1a_
   automated match to d1doab_
   complexed with gdp, mg

Details for d5fr1b_

PDB Entry: 5fr1, 2.75 Å

PDB Description: double acetylated rhogdi-alpha in complex with rhoa-gdp

PDB Compounds: (B:) rho GDP-dissociation inhibitor 1

SCOPe Domain Sequences for d5fr1b_:

Sequence, based on SEQRES records:

>d5fr1b_ b.1.18.8 (B:) automated matches {Bos taurus [TaxId: 9913]}
nykppaqksiqeiqeldkddeslrkykeallgrvavsadpnvpnvvvtrltlvcstapgp
leldltgdlesfkkqsfvlkegveyrikisfrvnreivsgmkyiqhtyrkgvkidktdym
vgsygpraeeyefltpmeeapkgmlargsyniksrftdddrtdhlswewnltikkew

Sequence, based on observed residues (ATOM records):

>d5fr1b_ b.1.18.8 (B:) automated matches {Bos taurus [TaxId: 9913]}
nykppaqksiqeiqeldkddeslrkykeallvpnvvvtrltlvcstapgpleldltgdle
sfkkqsfvlkegveyrikisfrvnreivsgmkyiqhtyrkgvkidktdymvgsygpraee
yefltpmeeapkgmlargsyniksrftdddrtdhlswewnltikkew

Timeline for d5fr1b_:

• d5fr1b_ is new in SCOPe 2.05-stable
  
• d5fr1b_ appears in SCOPe 2.06
  
• d5fr1b_ appears in the current release, SCOPe 2.08