![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.8: RhoGDI-like [81288] (3 proteins) |
![]() | Protein automated matches [190534] (3 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [280458] (1 PDB entry) |
![]() | Domain d5fr1b_: 5fr1 B: [280459] Other proteins in same PDB: d5fr1a_ automated match to d1doab_ complexed with gdp, mg |
PDB Entry: 5fr1 (more details), 2.75 Å
SCOPe Domain Sequences for d5fr1b_:
Sequence, based on SEQRES records: (download)
>d5fr1b_ b.1.18.8 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]} nykppaqksiqeiqeldkddeslrkykeallgrvavsadpnvpnvvvtrltlvcstapgp leldltgdlesfkkqsfvlkegveyrikisfrvnreivsgmkyiqhtyrkgvkidktdym vgsygpraeeyefltpmeeapkgmlargsyniksrftdddrtdhlswewnltikkew
>d5fr1b_ b.1.18.8 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]} nykppaqksiqeiqeldkddeslrkykeallvpnvvvtrltlvcstapgpleldltgdle sfkkqsfvlkegveyrikisfrvnreivsgmkyiqhtyrkgvkidktdymvgsygpraee yefltpmeeapkgmlargsyniksrftdddrtdhlswewnltikkew
Timeline for d5fr1b_: