Lineage for d5fpna1 (5fpn A:4-190)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2885061Species Human (Homo sapiens) [TaxId:9606] [224896] (72 PDB entries)
  8. 2885178Domain d5fpna1: 5fpn A:4-190 [280456]
    automated match to d1atra1
    complexed with kyd

Details for d5fpna1

PDB Entry: 5fpn (more details), 1.96 Å

PDB Description: structure of heat shock-related 70kda protein 2 with small- molecule ligand 3,5-dimethyl-1h-pyrazole-4-carboxylic acid (at9084) in an alternate binding site.
PDB Compounds: (A:) Heat shock-related 70 kDa protein 2

SCOPe Domain Sequences for d5fpna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fpna1 c.55.1.0 (A:4-190) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnp
tntifdakrligrkfedatvqsdmkhwpfrvvseggkpkvqveykgetktffpeeissmv
ltkmkeiaeaylggkvhsavitvpayfndsqrqatkdagtitglnvlriineptaaaiay
gldkkgc

SCOPe Domain Coordinates for d5fpna1:

Click to download the PDB-style file with coordinates for d5fpna1.
(The format of our PDB-style files is described here.)

Timeline for d5fpna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5fpna2