SCOPe 2.08: Domain d5fpna1: 5fpn A:4-190

Lineage for d5fpna1 (5fpn A:4-190)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (64 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224896] (72 PDB entries)

8. Domain d5fpna1: 5fpn A:4-190 [280456]
   automated match to d1atra1
   complexed with kyd

Details for d5fpna1

PDB Entry: 5fpn, 1.96 Å

PDB Description: structure of heat shock-related 70kda protein 2 with small- molecule ligand 3,5-dimethyl-1h-pyrazole-4-carboxylic acid (at9084) in an alternate binding site.

PDB Compounds: (A:) Heat shock-related 70 kDa protein 2

SCOPe Domain Sequences for d5fpna1:

Sequence; same for both SEQRES and ATOM records:

>d5fpna1 c.55.1.0 (A:4-190) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnp
tntifdakrligrkfedatvqsdmkhwpfrvvseggkpkvqveykgetktffpeeissmv
ltkmkeiaeaylggkvhsavitvpayfndsqrqatkdagtitglnvlriineptaaaiay
gldkkgc

Timeline for d5fpna1:

• d5fpna1 first appeared in SCOPe 2.05
  
• d5fpna1 appears in SCOPe 2.07