Lineage for d5fpma2 (5fpm A:192-385)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2883385Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2883861Protein automated matches [226905] (13 species)
    not a true protein
  7. 2883942Species Human (Homo sapiens) [TaxId:9606] [225574] (54 PDB entries)
  8. 2884036Domain d5fpma2: 5fpm A:192-385 [280445]
    automated match to d1atra2
    complexed with iwt

Details for d5fpma2

PDB Entry: 5fpm (more details), 1.96 Å

PDB Description: structure of heat shock-related 70kda protein 2 with small- molecule ligand 5-phenyl-1,3,4-oxadiazole-2-thiol (at809) in an alternate binding site.
PDB Compounds: (A:) heat shock-related 70kda protein 2

SCOPe Domain Sequences for d5fpma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fpma2 c.55.1.1 (A:192-385) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggeknvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvshlaeefkrkh
kkdigpnkravrrlrtacerakrtlssstqasieidslyegvdfytsitrarfeelnadl
frgtlepvekalrdakldkgqiqeivlvggstripkiqkllqdffngkelnksinpdeav
aygaavqaailigd

SCOPe Domain Coordinates for d5fpma2:

Click to download the PDB-style file with coordinates for d5fpma2.
(The format of our PDB-style files is described here.)

Timeline for d5fpma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5fpma1