SCOPe 2.08: Domain d5fpma2: 5fpm A:192-385

Lineage for d5fpma2 (5fpm A:192-385)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein automated matches [226905] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225574] (54 PDB entries)

8. Domain d5fpma2: 5fpm A:192-385 [280445]
   automated match to d1atra2
   complexed with iwt

Details for d5fpma2

PDB Entry: 5fpm, 1.96 Å

PDB Description: structure of heat shock-related 70kda protein 2 with small- molecule ligand 5-phenyl-1,3,4-oxadiazole-2-thiol (at809) in an alternate binding site.

PDB Compounds: (A:) heat shock-related 70kda protein 2

SCOPe Domain Sequences for d5fpma2:

Sequence; same for both SEQRES and ATOM records:

>d5fpma2 c.55.1.1 (A:192-385) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggeknvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvshlaeefkrkh
kkdigpnkravrrlrtacerakrtlssstqasieidslyegvdfytsitrarfeelnadl
frgtlepvekalrdakldkgqiqeivlvggstripkiqkllqdffngkelnksinpdeav
aygaavqaailigd

Timeline for d5fpma2:

• d5fpma2 first appeared in SCOPe 2.05
  
• d5fpma2 appears in SCOPe 2.07