![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.2: Bromodomain [47370] (2 families) ![]() |
![]() | Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
![]() | Protein automated matches [190615] (14 species) not a true protein |
![]() | Species Leishmania donovani [TaxId:981087] [274710] (2 PDB entries) |
![]() | Domain d5feab_: 5fea B: [280429] automated match to d2dvva_ complexed with bmf, br |
PDB Entry: 5fea (more details), 2.6 Å
SCOPe Domain Sequences for d5feab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5feab_ a.29.2.0 (B:) automated matches {Leishmania donovani [TaxId: 981087]} khahrqsletipevaelyhciyklyneeessvwfrepvnalaqeiftyydvvkspmslrh ildnivkgdtystalqvmedveliwkncitfngansllateagkcrsaldrirrayqddq r
Timeline for d5feab_: