Lineage for d5fe4a_ (5fe4 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706695Family a.29.2.1: Bromodomain [47371] (6 proteins)
  6. 2706816Protein automated matches [190366] (2 species)
    not a true protein
  7. 2706817Species Human (Homo sapiens) [TaxId:9606] [187201] (46 PDB entries)
  8. 2706909Domain d5fe4a_: 5fe4 A: [280413]
    automated match to d1wuma_
    complexed with 5wy, edo

Details for d5fe4a_

PDB Entry: 5fe4 (more details), 2.15 Å

PDB Description: crystal structure of human pcaf bromodomain in complex with fragment mb364 (fragment 5)
PDB Compounds: (A:) Histone acetyltransferase KAT2B

SCOPe Domain Sequences for d5fe4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fe4a_ a.29.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktmserlknryyv
skklfmadlqrvftnckeynppeseyykcanilekfffskikeaglid

SCOPe Domain Coordinates for d5fe4a_:

Click to download the PDB-style file with coordinates for d5fe4a_.
(The format of our PDB-style files is described here.)

Timeline for d5fe4a_: