SCOPe 2.06: Domain d5fe5a_: 5fe5 A:

Lineage for d5fe5a_ (5fe5 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.1: Bromodomain [47371] (5 proteins)

6. Protein automated matches [190366] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187201] (61 PDB entries)

8. Domain d5fe5a_: 5fe5 A: [280411]
   automated match to d1wuma_
   complexed with 2qc, dms, edo

Details for d5fe5a_

PDB Entry: 5fe5, 2.12 Å

PDB Description: crystal structure of human pcaf bromodomain in complex with fragment mb093 (fragment 7)

PDB Compounds: (A:) Histone acetyltransferase KAT2B

SCOPe Domain Sequences for d5fe5a_:

Sequence; same for both SEQRES and ATOM records:

>d5fe5a_ a.29.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktmserlknryyv
skklfmadlqrvftnckeynppeseyykcanilekfffskikeaglid

Timeline for d5fe5a_:

• d5fe5a_ first appeared in SCOPe 2.05
  
• d5fe5a_ appears in SCOPe 2.07
  
• d5fe5a_ appears in the current release, SCOPe 2.08