| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) ![]() |
| Family a.29.2.1: Bromodomain [47371] (6 proteins) |
| Protein automated matches [190366] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187201] (46 PDB entries) |
| Domain d5fe5a_: 5fe5 A: [280411] automated match to d1wuma_ complexed with 2qc, dms, edo |
PDB Entry: 5fe5 (more details), 2.12 Å
SCOPe Domain Sequences for d5fe5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fe5a_ a.29.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktmserlknryyv
skklfmadlqrvftnckeynppeseyykcanilekfffskikeaglid
Timeline for d5fe5a_: