SCOPe 2.05: Domain d5f6hn1: 5f6h N:2-111

Lineage for d5f6hn1 (5f6h N:2-111)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries)

8. Domain d5f6hn1: 5f6h N:2-111 [280405]
   Other proteins in same PDB: d5f6hj2, d5f6hl2, d5f6hn2, d5f6hp2
   automated match to d1aqkl1

Details for d5f6hn1

PDB Entry: 5f6h, 2.66 Å

PDB Description: crystal structure of tier 2 neutralizing antibody dh427 from a rhesus macaque

PDB Compounds: (N:) DH427 Antibody Light Chain

SCOPe Domain Sequences for d5f6hn1:

Sequence; same for both SEQRES and ATOM records:

>d5f6hn1 b.1.1.0 (N:2-111) automated matches {Homo sapiens [TaxId: 9606]}
saltqppsvskslgqsvtisctgtssdigaytgvswyqqhsgtaprlliydvskrpsgvs
drfsgsksgntasltisglqtddeadyyccsyrtgatyifgtgtrvtvlg

Timeline for d5f6hn1:

• d5f6hn1 is new in SCOPe 2.05-stable
  
• d5f6hn1 appears in SCOPe 2.06
  
• d5f6hn1 appears in the current release, SCOPe 2.08