SCOPe 2.08: Domain d5f6ic1: 5f6i C:1-111

Lineage for d5f6ic1 (5f6i C:1-111)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226133] (37 PDB entries)

8. Domain d5f6ic1: 5f6i C:1-111 [280402]
   Other proteins in same PDB: d5f6ib_, d5f6ic2
   automated match to d1aqkl1

Details for d5f6ic1

PDB Entry: 5f6i, 2.32 Å

PDB Description: crystal structure of tier 2 neutralizing antibody dh428 from a rhesus macaque

PDB Compounds: (C:) DH428 Antibody Light Chain

SCOPe Domain Sequences for d5f6ic1:

Sequence; same for both SEQRES and ATOM records:

>d5f6ic1 b.1.1.0 (C:1-111) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
qsaltqppsvskslgqsvtisctgtnsdigdyngvswyqqhsgtaprlliydvskrpsgv
sdrfsgsksgntasltisglqaedeadyyccsyrtggtyifgtgtrltvlg

Timeline for d5f6ic1:

• d5f6ic1 first appeared in SCOPe 2.05
  
• d5f6ic1 appears in SCOPe 2.07