SCOPe 2.06: Domain d5f6hl1: 5f6h L:2-111

Lineage for d5f6hl1 (5f6h L:2-111)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d5f6hl1: 5f6h L:2-111 [280399]
   Other proteins in same PDB: d5f6hj2, d5f6hl2, d5f6hn2, d5f6hp2
   automated match to d1aqkl1

Details for d5f6hl1

PDB Entry: 5f6h, 2.66 Å

PDB Description: crystal structure of tier 2 neutralizing antibody dh427 from a rhesus macaque

PDB Compounds: (L:) DH427 Antibody Light Chain

SCOPe Domain Sequences for d5f6hl1:

Sequence; same for both SEQRES and ATOM records:

>d5f6hl1 b.1.1.0 (L:2-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
saltqppsvskslgqsvtisctgtssdigaytgvswyqqhsgtaprlliydvskrpsgvs
drfsgsksgntasltisglqtddeadyyccsyrtgatyifgtgtrvtvlg

Timeline for d5f6hl1:

• d5f6hl1 first appeared in SCOPe 2.05
  
• d5f6hl1 appears in SCOPe 2.07
  
• d5f6hl1 appears in the current release, SCOPe 2.08