SCOPe 2.05: Domain d5f6hj2: 5f6h J:112-213

Lineage for d5f6hj2 (5f6h J:112-213)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (14 species)
not a true protein
Species Homo sapiens [TaxId:9606] [268989] (70 PDB entries)
Domain d5f6hj2: 5f6h J:112-213 [280398]
Other proteins in same PDB: d5f6hj1, d5f6hl1, d5f6hn1, d5f6hp1
automated match to d1aqkl2

Details for d5f6hj2

PDB Entry: 5f6h (more details), 2.66 Å

PDB Description: crystal structure of tier 2 neutralizing antibody dh427 from a rhesus macaque

PDB Compounds: (J:) DH427 Antibody Light Chain

SCOPe Domain Sequences for d5f6hj2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f6hj2 b.1.1.2 (J:112-213) automated matches {Homo sapiens [TaxId: 9606]}
qpkgapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

SCOPe Domain Coordinates for d5f6hj2:

Click to download the PDB-style file with coordinates for d5f6hj2.
(The format of our PDB-style files is described here.)

Timeline for d5f6hj2: