Lineage for d5farb_ (5far B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2207295Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2207296Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2207860Family d.96.1.0: automated matches [227243] (1 protein)
    not a true family
  6. 2207861Protein automated matches [227009] (13 species)
    not a true protein
  7. 2207873Species Bacillus cereus [TaxId:1053183] [280391] (1 PDB entry)
  8. 2207875Domain d5farb_: 5far B: [280394]
    automated match to d3o1kd_
    complexed with 9mg

Details for d5farb_

PDB Entry: 5far (more details), 2 Å

PDB Description: crystal structure of dihydroneopterin aldolase from bacillus anthracis complex with 9-methylguanine
PDB Compounds: (B:) 7,8-dihydroneopterin aldolase

SCOPe Domain Sequences for d5farb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5farb_ d.96.1.0 (B:) automated matches {Bacillus cereus [TaxId: 1053183]}
mdkiyihdmefygyhgvfpeenklgqrfkvdltveldlkragesddlehsvnygelfelc
rkvvedrtyklvesiaeniatdilkqyesisrctikvikpdppipghyravaveitrer

SCOPe Domain Coordinates for d5farb_:

Click to download the PDB-style file with coordinates for d5farb_.
(The format of our PDB-style files is described here.)

Timeline for d5farb_: