SCOPe 2.06: Domain d5esvd2: 5esv D:107-213

Lineage for d5esvd2 (5esv D:107-213)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

8. Domain d5esvd2: 5esv D:107-213 [280384]
   Other proteins in same PDB: d5esvb1, d5esvd1, d5esvl1
   automated match to d1dn0a2
   complexed with bma, man, nag, zn

Details for d5esvd2

PDB Entry: 5esv, 3.11 Å

PDB Description: crystal structure of broadly neutralizing antibody ch03, isolated from donor ch0219, in complex with scaffolded trimeric hiv-1 env v1v2 domain from the clade c superinfecting strain of donor cap256.

PDB Compounds: (D:) CH03 Light Chain

SCOPe Domain Sequences for d5esvd2:

Sequence; same for both SEQRES and ATOM records:

>d5esvd2 b.1.1.2 (D:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d5esvd2:

• d5esvd2 first appeared in SCOPe 2.05
  
• d5esvd2 appears in SCOPe 2.07
  
• d5esvd2 appears in the current release, SCOPe 2.08