SCOPe 2.06: Domain d5esvd1: 5esv D:1-106

Lineage for d5esvd1 (5esv D:1-106)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d5esvd1: 5esv D:1-106 [280383]
   Other proteins in same PDB: d5esvb2, d5esvd2, d5esvl2
   automated match to d1dn0a1
   complexed with bma, man, nag, zn

Details for d5esvd1

PDB Entry: 5esv, 3.11 Å

PDB Description: crystal structure of broadly neutralizing antibody ch03, isolated from donor ch0219, in complex with scaffolded trimeric hiv-1 env v1v2 domain from the clade c superinfecting strain of donor cap256.

PDB Compounds: (D:) CH03 Light Chain

SCOPe Domain Sequences for d5esvd1:

Sequence; same for both SEQRES and ATOM records:

>d5esvd1 b.1.1.0 (D:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspatlslspgeratlscrasqsvhpkyfawyqqkpgqsprlliysgstraagia
drfsgggsgihftltitrvepedfavyfcqqyggspytfgqgtkvel

Timeline for d5esvd1:

• d5esvd1 first appeared in SCOPe 2.05
  
• d5esvd1 appears in SCOPe 2.07
  
• d5esvd1 appears in the current release, SCOPe 2.08