Lineage for d5etxc_ (5etx C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1795140Family b.47.1.3: Viral proteases [50596] (5 protein domains)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 1795230Protein automated matches [190658] (4 species)
    not a true protein
  7. 1795268Species Hepatitis C virus [TaxId:11103] [189262] (8 PDB entries)
  8. 1795279Domain d5etxc_: 5etx C: [280362]
    automated match to d3sv9a_
    complexed with 5rs, cl, zn

Details for d5etxc_

PDB Entry: 5etx (more details), 2.35 Å

PDB Description: crystal structure of hcv ns3/4a protease a156t variant in complex with 5172-linear (mk-5172 linear analogue)
PDB Compounds: (C:) NS3 protease

SCOPe Domain Sequences for d5etxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5etxc_ b.47.1.3 (C:) automated matches {Hepatitis C virus [TaxId: 11103]}
kkkgsvvivgrinlsgdtayaqqtrgeegcqetsqtgrdknqvegevqivstatqtflat
singvlwtvyhgagtrtiaspkgpvtqmytnvdkdlvgwqapqgsrsltpctcgssdlyl
vtrhadvipvrrrgdsrgsllsprpisylkgssggpllcpaghavgifrtavstrgvaka
vdfipveslettm

SCOPe Domain Coordinates for d5etxc_:

Click to download the PDB-style file with coordinates for d5etxc_.
(The format of our PDB-style files is described here.)

Timeline for d5etxc_:

  • d5etxc_ appears in periodic updates to SCOPe 2.05 starting on 2016-01-14
  • d5etxc_ is called d5etxc1 in SCOPe 2.06
  • d5etxc_ appears in the current release, SCOPe 2.07, called d5etxc1