Lineage for d1qjvb_ (1qjv B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 380828Fold b.80: Single-stranded right-handed beta-helix [51125] (7 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 380829Superfamily b.80.1: Pectin lyase-like [51126] (11 families) (S)
    superhelix turns are made of 3 strands each
  5. 380903Family b.80.1.5: Pectin methylesterase [51147] (1 protein)
    this is a repeat family; one repeat unit is 1qjv A:170-291 found in domain
  6. 380904Protein Pectin methylesterase PemA [51148] (2 species)
  7. 380907Species Erwinia chrysanthemi [TaxId:556] [51149] (1 PDB entry)
  8. 380909Domain d1qjvb_: 1qjv B: [28036]
    CASP4
    complexed with cl

Details for d1qjvb_

PDB Entry: 1qjv (more details), 2.37 Å

PDB Description: pectin methylesterase pema from erwinia chrysanthemi

SCOP Domain Sequences for d1qjvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qjvb_ b.80.1.5 (B:) Pectin methylesterase PemA {Erwinia chrysanthemi}
attynavvsksssdgktfktiadaiasapagstpfvilikngvynerltitrnnlhlkge
srngaviaaataagtlksdgskwgtagsstitisakdfsaqsltirndfdfpanqaksds
dsskikdtqavalyvtksgdrayfkdvslvgyqdtlyvsggrsffsdcrisgtvdfifgd
gtalfnncdlvsryradvksgnvsgyltapstninqkyglvitnsrviresdsvpaksyg
lgrpwhptttfsdgryadpnaigqtvflntsmdnhiygwdkmsgkdkngntiwfnpedsr
ffeyksygagaavskdrrqltdaqaaeytqskvlgdwtptlp

SCOP Domain Coordinates for d1qjvb_:

Click to download the PDB-style file with coordinates for d1qjvb_.
(The format of our PDB-style files is described here.)

Timeline for d1qjvb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qjva_