Lineage for d5es3c1 (5es3 C:1-159)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847859Species Norway rat (Rattus norvegicus) [TaxId:10116] [226329] (13 PDB entries)
  8. 2847906Domain d5es3c1: 5es3 C:1-159 [280356]
    Other proteins in same PDB: d5es3a2, d5es3b2, d5es3c2, d5es3d2, d5es3e2, d5es3f2, d5es3g2, d5es3h2
    automated match to d9ldta1
    complexed with oxm

Details for d5es3c1

PDB Entry: 5es3 (more details), 2.29 Å

PDB Description: co-crystal structure of ldh liganded with oxamate
PDB Compounds: (C:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d5es3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5es3c1 c.2.1.0 (C:1-159) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aalkdqlivnllkeeqvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkyspqckllivsnpvdiltyvawkisgfpknrvig

SCOPe Domain Coordinates for d5es3c1:

Click to download the PDB-style file with coordinates for d5es3c1.
(The format of our PDB-style files is described here.)

Timeline for d5es3c1: