Lineage for d1qjva_ (1qjv A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2069178Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2069179Superfamily b.80.1: Pectin lyase-like [51126] (12 families) (S)
    superhelix turns are made of 3 strands each
  5. 2069277Family b.80.1.5: Pectin methylesterase [51147] (2 protein domains)
    automatically mapped to Pfam PF01095
  6. 2069278Protein Pectin methylesterase PemA [51148] (2 species)
  7. 2069281Species Erwinia chrysanthemi [TaxId:556] [51149] (1 PDB entry)
  8. 2069282Domain d1qjva_: 1qjv A: [28035]
    CASP4
    complexed with cl

Details for d1qjva_

PDB Entry: 1qjv (more details), 2.37 Å

PDB Description: pectin methylesterase pema from erwinia chrysanthemi
PDB Compounds: (A:) pectin methylesterase

SCOPe Domain Sequences for d1qjva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qjva_ b.80.1.5 (A:) Pectin methylesterase PemA {Erwinia chrysanthemi [TaxId: 556]}
attynavvsksssdgktfktiadaiasapagstpfvilikngvynerltitrnnlhlkge
srngaviaaataagtlksdgskwgtagsstitisakdfsaqsltirndfdfpanqaksds
dsskikdtqavalyvtksgdrayfkdvslvgyqdtlyvsggrsffsdcrisgtvdfifgd
gtalfnncdlvsryradvksgnvsgyltapstninqkyglvitnsrviresdsvpaksyg
lgrpwhptttfsdgryadpnaigqtvflntsmdnhiygwdkmsgkdkngntiwfnpedsr
ffeyksygagaavskdrrqltdaqaaeytqskvlgdwtptlp

SCOPe Domain Coordinates for d1qjva_:

Click to download the PDB-style file with coordinates for d1qjva_.
(The format of our PDB-style files is described here.)

Timeline for d1qjva_: