Lineage for d5dx5a_ (5dx5 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132428Species Clostridium sporogenes [TaxId:1509] [280343] (1 PDB entry)
  8. 2132429Domain d5dx5a_: 5dx5 A: [280345]
    automated match to d1e5ea_
    complexed with cl, na, plp

Details for d5dx5a_

PDB Entry: 5dx5 (more details), 2.37 Å

PDB Description: crystal structure of methionine gamma-lyase from clostridium sporogenes
PDB Compounds: (A:) methionine gamma-lyase

SCOPe Domain Sequences for d5dx5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dx5a_ c.67.1.0 (A:) automated matches {Clostridium sporogenes [TaxId: 1509]}
enikkmgfatkaihgghigdkqfgslatpiyqtstfifdsaeqggrrfageesgyiysrl
gnptstevenklalleggeaavvaasgmgaiaaslwsalksgdhvvasdtlygctfalln
hgltrygvevtfvdvsnldevknalkpntkvvyletpanptlkvtdirkisnmvhesnke
cfvfvdntfctpyiqrplelgadvvvhsatkylnghgdviagfavgkeefinqvklfgik
dmtgsvtgpfesfliirgmktlqlrmekhcknamevakfleshpavekvyypglesfkyy
qlareqmklpgamisfelkggveegkivmnnvklatlavslgdsetliqhpasmthspyt
aeerkaagisdglvrlsvgledaediiddlkqaldlivk

SCOPe Domain Coordinates for d5dx5a_:

Click to download the PDB-style file with coordinates for d5dx5a_.
(The format of our PDB-style files is described here.)

Timeline for d5dx5a_: