Lineage for d1dboa_ (1dbo A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2069178Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2069179Superfamily b.80.1: Pectin lyase-like [51126] (12 families) (S)
    superhelix turns are made of 3 strands each
  5. 2069270Family b.80.1.4: Chondroitinase B [51144] (1 protein)
  6. 2069271Protein Chondroitinase B [51145] (1 species)
  7. 2069272Species Pedobacter heparinus [TaxId:984] [51146] (4 PDB entries)
    Uniprot Q46079 27-506
    synonym: Flavobacterium heparinum
  8. 2069276Domain d1dboa_: 1dbo A: [28034]

Details for d1dboa_

PDB Entry: 1dbo (more details), 1.7 Å

PDB Description: crystal structure of chondroitinase b
PDB Compounds: (A:) chondroitinase b

SCOPe Domain Sequences for d1dboa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dboa_ b.80.1.4 (A:) Chondroitinase B {Pedobacter heparinus [TaxId: 984]}
qvvasnetlyqvvkevkpgglvqiadgtykdvqlivsnsgksglpitikalnpgkvfftg
dakvelrgehlilegiwfkdgnraiqawkshgpglvaiygsynritacvfdcfdeansay
ittsltedgkvpqhcridhcsftdkitfdqvinlnntaraikdgsvggpgmyhrvdhcff
snpqkpgnagggirigyyrndigrclvdsnlfmrqdseaeiitsksqenvyygntylncq
gtmnfrhgdhqvainnfyigndqrfgyggmfvwgsrhviacnyfelsetiksrgnaalyl
npgamasehalafdmliannafinvngyaihfnplderrkeycaanrlkfetphqlmlkg
nlffkdkpyvypffkddyfiagknswtgnvalgvekgipvnisanrsaykpvkikdiqpi
egialdlnaliskgitgkplswdevrpywlkempgtyaltarlsadraakfkavikrnke
h

SCOPe Domain Coordinates for d1dboa_:

Click to download the PDB-style file with coordinates for d1dboa_.
(The format of our PDB-style files is described here.)

Timeline for d1dboa_: