Lineage for d5dvbd1 (5dvb D:1-166)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877880Protein automated matches [190100] (21 species)
    not a true protein
  7. 2878134Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226432] (2 PDB entries)
  8. 2878138Domain d5dvbd1: 5dvb D:1-166 [280338]
    Other proteins in same PDB: d5dvba2, d5dvbb2, d5dvbc2, d5dvbd2, d5dvbe2, d5dvbf2, d5dvbg2, d5dvbh2, d5dvbi2, d5dvbj2
    automated match to d3sbcb_

Details for d5dvbd1

PDB Entry: 5dvb (more details), 2.2 Å

PDB Description: crystal structure of s. cerevisiae tsa2
PDB Compounds: (D:) Tsa2p

SCOPe Domain Sequences for d5dvbd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dvbd1 c.47.1.10 (D:1-166) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mvaevqkqappfkktavvdgifeeislekykgkyvvlafvplafsfvspteivafsdaak
kfedqgaqvlfastdseysllawtnlprkdgglgpvkvplladknhslsrdygvliekeg
ialrglfiidpkgiirhitindlsvgrnvnealrlvegfqwtdkng

SCOPe Domain Coordinates for d5dvbd1:

Click to download the PDB-style file with coordinates for d5dvbd1.
(The format of our PDB-style files is described here.)

Timeline for d5dvbd1: