Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.50: Macro domain-like [52948] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest |
Superfamily c.50.1: Macro domain-like [52949] (4 families) |
Family c.50.1.0: automated matches [191326] (1 protein) not a true family |
Protein automated matches [190146] (11 species) not a true protein |
Species Middle east respiratory syndrome coronavirus [TaxId:1335626] [280335] (3 PDB entries) |
Domain d5dusa1: 5dus A:1-164 [280336] Other proteins in same PDB: d5dusa2 automated match to d2acfd_ complexed with apr, gol, so4 |
PDB Entry: 5dus (more details), 1.43 Å
SCOPe Domain Sequences for d5dusa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dusa1 c.50.1.0 (A:1-164) automated matches {Middle east respiratory syndrome coronavirus [TaxId: 1335626]} plsnfehkvitecvtivlgdaiqvakcygesvlvnaanthlkhgggiagainaaskgavq kesdeyilakgplqvgdsvllqghslaknilhvvgpdarakqdvsllskcykamnayplv vtplvsagifgvkpavsfdylireaktrvlvvvnsqdvykslti
Timeline for d5dusa1: