Lineage for d5d8jl1 (5d8j L:1-108)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2761225Domain d5d8jl1: 5d8j L:1-108 [280322]
    Other proteins in same PDB: d5d8ja1, d5d8ja2, d5d8jh1, d5d8jh2, d5d8jl2
    automated match to d1h3pl1
    complexed with so4

Details for d5d8jl1

PDB Entry: 5d8j (more details), 3 Å

PDB Description: development of a therapeutic monoclonal antibody targeting secreted ap2 to treat type 2 diabetes.
PDB Compounds: (L:) HA3 Fab Light Chain

SCOPe Domain Sequences for d5d8jl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d8jl1 b.1.1.0 (L:1-108) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evvltqspalmaaspgekvtitcsvsssisssnlhwyqqksetspkpwiygtsnlasgvp
vrfsgsgsgtsysltissmeaedaatyycqqwshypltfgagtklelk

SCOPe Domain Coordinates for d5d8jl1:

Click to download the PDB-style file with coordinates for d5d8jl1.
(The format of our PDB-style files is described here.)

Timeline for d5d8jl1: