![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
![]() | Family d.110.3.0: automated matches [191387] (1 protein) not a true family |
![]() | Protein automated matches [190492] (24 species) not a true protein |
![]() | Species Phaeodactylum tricornutum [TaxId:2850] [280317] (4 PDB entries) |
![]() | Domain d5dkka_: 5dkk A: [280320] automated match to d3ue6e_ complexed with act, edo, fmn |
PDB Entry: 5dkk (more details), 2.5 Å
SCOPe Domain Sequences for d5dkka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dkka_ d.110.3.0 (A:) automated matches {Phaeodactylum tricornutum [TaxId: 2850]} fsfikalqtaqqnfvvtdpslpdnpivyasqgflnltgysldqilgrncrflqgpetdpk averirkaieqgndmsvcllnyrvdgttfwnqffiaalrdaggnvtnfvgvqckvsdqya atvtkqqeeeeeaa
Timeline for d5dkka_: