SCOPe 2.08: Domain d5dklb_: 5dkl B:

Lineage for d5dklb_ (5dkl B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.0: automated matches [191387] (1 protein)
   not a true family

6. Protein automated matches [190492] (24 species)
   not a true protein

7. Species Phaeodactylum tricornutum [TaxId:2850] [280317] (4 PDB entries)

8. Domain d5dklb_: 5dkl B: [280318]
   automated match to d3ue6e_
   complexed with fmn

Details for d5dklb_

PDB Entry: 5dkl, 2.7 Å

PDB Description: structure of the light-state dimer of the blue light photoreceptor aureochrome 1a lov from p. tricornutum

PDB Compounds: (B:) LOV domain

SCOPe Domain Sequences for d5dklb_:

Sequence; same for both SEQRES and ATOM records:

>d5dklb_ d.110.3.0 (B:) automated matches {Phaeodactylum tricornutum [TaxId: 2850]}
gamgdfsfikalqtaqqnfvvtdpslpdnpivyasqgflnltgysldqilgrncrflqgp
etdpkaverirkaieqgndmsvcllnyrvdgttfwnqffiaalrdaggnvtnfvgvqckv
sdqyaatvtkqqeeeee

Timeline for d5dklb_:

• d5dklb_ first appeared in SCOPe 2.05
  
• d5dklb_ appears in SCOPe 2.07