SCOP 1.73: Domain d1czfa_: 1czf A:

Lineage for d1czfa_ (1czf A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.80.1: Pectin lyase-like [51126] (11 families)
   superhelix turns are made of 3 strands each

5. Family b.80.1.3: Galacturonase [51137] (2 proteins)
   this is a repeat family; one repeat unit is 1bhe A:244-269 found in domain

6. Protein Polygalacturonase [51140] (6 species)

7. Species Fungus (Aspergillus niger), endo-polygalacturonase II [TaxId:5061] [63382] (1 PDB entry)

8. Domain d1czfa_: 1czf A: [28031]

Details for d1czfa_

PDB Entry: 1czf, 1.68 Å

PDB Description: endo-polygalacturonase ii from aspergillus niger

PDB Compounds: (A:) polygalacturonase II

SCOP Domain Sequences for d1czfa_:

Sequence; same for both SEQRES and ATOM records:

>d1czfa_ b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergillus niger), endo-polygalacturonase II [TaxId: 5061]}
dsctfttaaaakagkakcstitlnnievpagttldltgltsgtkvifegtttfqyeewag
plismsgehitvtgasghlincdgarwwdgkgtsgkkkpkffyahgldsssitglniknt
plmafsvqanditftdvtinnadgdtqgghntdafdvgnsvgvniikpwvhnqddclavn
sgeniwftggtcigghglsigsvgdrsnnvvknvtiehstvsnsenavriktisgatgsv
seitysnivmsgisdygvviqqdyedgkptgkptngvtiqdvklesvtgsvdsgateiyl
lcgsgscsdwtwddvkvtggkkstacknfpsvasc

Timeline for d1czfa_:

• d1czfa_ first appeared (with stable ids) in SCOP 1.55
  
• d1czfa_ appears in SCOP 1.71
  
• d1czfa_ appears in SCOP 1.75
  
• d1czfa_ appears in the current release, SCOPe 2.08