Lineage for d5d7wa1 (5d7w A:4-246)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2204983Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2206178Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2206179Protein automated matches [190805] (17 species)
    not a true protein
  7. 2206318Species Serratia marcescens [TaxId:615] [280300] (1 PDB entry)
  8. 2206319Domain d5d7wa1: 5d7w A:4-246 [280301]
    Other proteins in same PDB: d5d7wa2, d5d7wa3
    automated match to d1go7p2
    complexed with ca, gol, zn

Details for d5d7wa1

PDB Entry: 5d7w (more details), 1.1 Å

PDB Description: crystal structure of serralysin
PDB Compounds: (A:) serralysin

SCOPe Domain Sequences for d5d7wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d7wa1 d.92.1.0 (A:4-246) automated matches {Serratia marcescens [TaxId: 615]}
tgydavddllhyhergngiqingkdsfsneqaglfitrenqtwngykvfgqpvkltfsfp
dykfsstnvagdtglskfsaeqqqqaklslqswadvanitftevaagqkanitfgnysqd
rpghydygtqayaflpntiwqgqdlggqtwynvnqsnvkhpatedygrqtftheighalg
lshpgdynagegnptyndvtyaedtrqfslmsywsetntggdngghyaaapllddiaaiq
hly

SCOPe Domain Coordinates for d5d7wa1:

Click to download the PDB-style file with coordinates for d5d7wa1.
(The format of our PDB-style files is described here.)

Timeline for d5d7wa1: