Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
Protein automated matches [190805] (17 species) not a true protein |
Species Serratia marcescens [TaxId:615] [280300] (1 PDB entry) |
Domain d5d7wa1: 5d7w A:4-246 [280301] Other proteins in same PDB: d5d7wa2, d5d7wa3 automated match to d1go7p2 complexed with ca, gol, zn |
PDB Entry: 5d7w (more details), 1.1 Å
SCOPe Domain Sequences for d5d7wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d7wa1 d.92.1.0 (A:4-246) automated matches {Serratia marcescens [TaxId: 615]} tgydavddllhyhergngiqingkdsfsneqaglfitrenqtwngykvfgqpvkltfsfp dykfsstnvagdtglskfsaeqqqqaklslqswadvanitftevaagqkanitfgnysqd rpghydygtqayaflpntiwqgqdlggqtwynvnqsnvkhpatedygrqtftheighalg lshpgdynagegnptyndvtyaedtrqfslmsywsetntggdngghyaaapllddiaaiq hly
Timeline for d5d7wa1: