Lineage for d1bhe__ (1bhe -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17707Fold b.80: Single-stranded right-handed beta-helix [51125] (2 superfamilies)
  4. 17708Superfamily b.80.1: Pectin lyase-like [51126] (7 families) (S)
  5. 17730Family b.80.1.3: Galacturonase [51137] (3 proteins)
  6. 17735Protein Polygalacturonase [51140] (1 species)
  7. 17736Species Erwinia carotovora, subsp. carotovora [TaxId:554] [51141] (1 PDB entry)
  8. 17737Domain d1bhe__: 1bhe - [28030]

Details for d1bhe__

PDB Entry: 1bhe (more details), 1.9 Å

PDB Description: polygalacturonase from erwinia carotovora ssp. carotovora

SCOP Domain Sequences for d1bhe__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhe__ b.80.1.3 (-) Polygalacturonase {Erwinia carotovora, subsp. carotovora}
sdsrtvsepktpsscttlkadsstatstiqkalnncdqgkavrlsagstsvflsgplslp
sgvsllidkgvtlravnnaksfenapsscgvvdkngkgcdafitavsttnsgiygpgtid
gqggvklqdkkvswwelaadakvkklkqntprliqinksknftlynvslinspnfhvvfs
dgdgftawkttiktpstarntdgidpmssknitiaysniatgddnvaikaykgraetrni
silhndfgtghgmsigsetmgvynvtvddlkmngttnglriksdksaagvvngvrysnvv
mknvakpividtvyekkegsnvpdwsditfkdvtsetkgvvvlngenakkpievtmknvk
ltsdstwqiknvnvkk

SCOP Domain Coordinates for d1bhe__:

Click to download the PDB-style file with coordinates for d1bhe__.
(The format of our PDB-style files is described here.)

Timeline for d1bhe__: