Lineage for d1bhea_ (1bhe A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2069178Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2069179Superfamily b.80.1: Pectin lyase-like [51126] (12 families) (S)
    superhelix turns are made of 3 strands each
  5. 2069234Family b.80.1.3: Galacturonase [51137] (3 protein domains)
  6. 2069235Protein Polygalacturonase [51140] (6 species)
  7. 2069236Species Erwinia carotovora, subsp. carotovora [TaxId:554] [51141] (1 PDB entry)
  8. 2069237Domain d1bhea_: 1bhe A: [28030]
    CASP3

Details for d1bhea_

PDB Entry: 1bhe (more details), 1.9 Å

PDB Description: polygalacturonase from erwinia carotovora ssp. carotovora
PDB Compounds: (A:) polygalacturonase

SCOPe Domain Sequences for d1bhea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhea_ b.80.1.3 (A:) Polygalacturonase {Erwinia carotovora, subsp. carotovora [TaxId: 554]}
sdsrtvsepktpsscttlkadsstatstiqkalnncdqgkavrlsagstsvflsgplslp
sgvsllidkgvtlravnnaksfenapsscgvvdkngkgcdafitavsttnsgiygpgtid
gqggvklqdkkvswwelaadakvkklkqntprliqinksknftlynvslinspnfhvvfs
dgdgftawkttiktpstarntdgidpmssknitiaysniatgddnvaikaykgraetrni
silhndfgtghgmsigsetmgvynvtvddlkmngttnglriksdksaagvvngvrysnvv
mknvakpividtvyekkegsnvpdwsditfkdvtsetkgvvvlngenakkpievtmknvk
ltsdstwqiknvnvkk

SCOPe Domain Coordinates for d1bhea_:

Click to download the PDB-style file with coordinates for d1bhea_.
(The format of our PDB-style files is described here.)

Timeline for d1bhea_: