SCOPe 2.07: Domain d4d3cl2: 4d3c L:108-209

Lineage for d4d3cl2 (4d3c L:108-209)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [226687] (4 PDB entries)

8. Domain d4d3cl2: 4d3c L:108-209 [280299]
   Other proteins in same PDB: d4d3ca1, d4d3cl1
   automated match to d1dn0a2

Details for d4d3cl2

PDB Entry: 4d3c, 2.62 Å

PDB Description: crystal structure of the nk1 domain of hgf in complex with anti-hgf monoclonal antibody sfn68.

PDB Compounds: (L:) sfn68 fab

SCOPe Domain Sequences for d4d3cl2:

Sequence; same for both SEQRES and ATOM records:

>d4d3cl2 b.1.1.2 (L:108-209) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtks

Timeline for d4d3cl2:

• d4d3cl2 first appeared in SCOPe 2.05
  
• d4d3cl2 appears in SCOPe 2.06
  
• d4d3cl2 appears in the current release, SCOPe 2.08