Lineage for d4d3cl2 (4d3c L:108-209)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2753415Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [226687] (5 PDB entries)
  8. 2753417Domain d4d3cl2: 4d3c L:108-209 [280299]
    Other proteins in same PDB: d4d3ca1, d4d3ch_, d4d3cl1
    automated match to d1dn0a2

Details for d4d3cl2

PDB Entry: 4d3c (more details), 2.62 Å

PDB Description: crystal structure of the nk1 domain of hgf in complex with anti-hgf monoclonal antibody sfn68.
PDB Compounds: (L:) sfn68 fab

SCOPe Domain Sequences for d4d3cl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d3cl2 b.1.1.2 (L:108-209) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtks

SCOPe Domain Coordinates for d4d3cl2:

Click to download the PDB-style file with coordinates for d4d3cl2.
(The format of our PDB-style files is described here.)

Timeline for d4d3cl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4d3cl1