![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (26 species) not a true protein |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (15 PDB entries) |
![]() | Domain d4d3cl1: 4d3c L:1-107 [280298] Other proteins in same PDB: d4d3ca1, d4d3cl2 automated match to d1dn0a1 |
PDB Entry: 4d3c (more details), 2.62 Å
SCOPe Domain Sequences for d4d3cl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4d3cl1 b.1.1.0 (L:1-107) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} eldltqtpssvsaavggtvtincqasqsvsnllawyqqkpgqppklliygasnlesgvps rfrgsgsgteftltisgmkaedaatyycqsgyysagatfgagtnvei
Timeline for d4d3cl1: