SCOPe 2.06: Domain d4d3ca1: 4d3c A:127-208

Lineage for d4d3ca1 (4d3c A:127-208)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (3 families)

5. Family g.14.1.1: Kringle modules [57441] (7 proteins)

6. Protein automated matches [226950] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225942] (11 PDB entries)

8. Domain d4d3ca1: 4d3c A:127-208 [280295]
   Other proteins in same PDB: d4d3cl1, d4d3cl2
   automated match to d3hn4a2

Details for d4d3ca1

PDB Entry: 4d3c, 2.62 Å

PDB Description: crystal structure of the nk1 domain of hgf in complex with anti-hgf monoclonal antibody sfn68.

PDB Compounds: (A:) hepatocyte growth factor

SCOPe Domain Sequences for d4d3ca1:

Sequence; same for both SEQRES and ATOM records:

>d4d3ca1 g.14.1.1 (A:127-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nciigkggsykgtvsitksgikcqpwssmiphehsflpssyrgkdlqenycrnprgeegg
pwcftsnpevryevcdipqcse

Timeline for d4d3ca1:

• d4d3ca1 first appeared in SCOPe 2.05
  
• d4d3ca1 appears in SCOPe 2.07
  
• d4d3ca1 appears in the current release, SCOPe 2.08