Lineage for d1rmga_ (1rmg A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2069178Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2069179Superfamily b.80.1: Pectin lyase-like [51126] (12 families) (S)
    superhelix turns are made of 3 strands each
  5. 2069234Family b.80.1.3: Galacturonase [51137] (3 protein domains)
  6. 2069258Protein Rhamnogalacturonase A [51138] (1 species)
  7. 2069259Species Fungus (Aspergillus aculeatus) [TaxId:5053] [51139] (1 PDB entry)
  8. 2069260Domain d1rmga_: 1rmg A: [28029]
    complexed with bma, glc, man

Details for d1rmga_

PDB Entry: 1rmg (more details), 2 Å

PDB Description: rhamnogalacturonase a from aspergillus aculeatus
PDB Compounds: (A:) rhamnogalacturonase a

SCOPe Domain Sequences for d1rmga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rmga_ b.80.1.3 (A:) Rhamnogalacturonase A {Fungus (Aspergillus aculeatus) [TaxId: 5053]}
qlsgsvgpltsastkgatktcnilsygavadnstdvgpaitsawaacksgglvyipsgny
alntwvtltggsataiqldgiiyrtgtasgnmiavtdttdfelfsstskgavqgfgyvyh
aegtygarilrltdvthfsvhdiilvdapafhftmdtcsdgevynmairggneggldgid
vwgsniwvhdvevtnkdecvtvkspannilvesiycnwsggcamgslgadtdvtdivyrn
vytwssnqmymiksnggsgtvsnvllenfighgnaysldidgywssmtavagdgvqlnni
tvknwkgteangatrppirvvcsdtapctdltlediaiwtesgsselylcrsaygsgycl
kdssshtsytttstvtaapsgysattmaadlatafgltasipiptiptsfypgltpysal
ag

SCOPe Domain Coordinates for d1rmga_:

Click to download the PDB-style file with coordinates for d1rmga_.
(The format of our PDB-style files is described here.)

Timeline for d1rmga_: