SCOPe 2.05: Domain d5coka_: 5cok A:

Lineage for d5coka_ (5cok A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (8 species)

7. Species Human immunodeficiency virus 1 [TaxId:11676] [224867] (48 PDB entries)

8. Domain d5coka_: 5cok A: [280288]
   automated match to d3ggva_
   complexed with 52u

Details for d5coka_

PDB Entry: 5cok, 1.8 Å

PDB Description: x-ray crystal structure of wild type hiv-1 protease in complex with grl-0476

PDB Compounds: (A:) hiv-1 protease

SCOPe Domain Sequences for d5coka_:

Sequence; same for both SEQRES and ATOM records:

>d5coka_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwqrplvtikiggqlkeallntgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d5coka_:

• d5coka_ is new in SCOPe 2.05-stable
  
• d5coka_ appears in SCOPe 2.06
  
• d5coka_ appears in the current release, SCOPe 2.08