SCOPe 2.05: Domain d5copb_: 5cop B:

Lineage for d5copb_ (5cop B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (8 species)

7. Species Human immunodeficiency virus 1 [TaxId:11676] [224867] (48 PDB entries)

8. Domain d5copb_: 5cop B: [280284]
   automated match to d3ggva_
   complexed with 53f

Details for d5copb_

PDB Entry: 5cop, 2 Å

PDB Description: x-ray crystal structure of wild type hiv-1 protease in complex with grl-097

PDB Compounds: (B:) hiv-1 protease

SCOPe Domain Sequences for d5copb_:

Sequence; same for both SEQRES and ATOM records:

>d5copb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwqrplvtikiggqlkeallntgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d5copb_:

• d5copb_ is new in SCOPe 2.05-stable
  
• d5copb_ appears in SCOPe 2.06
  
• d5copb_ appears in the current release, SCOPe 2.08