SCOPe 2.05: Domain d5cm9c_: 5cm9 C:

Lineage for d5cm9c_ (5cm9 C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225598] (7 PDB entries)

8. Domain d5cm9c_: 5cm9 C: [280276]
   automated match to d2bcgy_

Details for d5cm9c_

PDB Entry: 5cm9, 2.6 Å

PDB Description: structural basis for the selectivity of guanine nucleotide exchange factors for the small g-protein ral

PDB Compounds: (C:) Ras-related protein Ral-A

SCOPe Domain Sequences for d5cm9c_:

Sequence, based on SEQRES records:

>d5cm9c_ c.37.1.0 (C:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
alhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildtagq
edyaairdnyfrsgegflcvfsitddesfqatqefreqilrvkndesipfllvgnkcdln
dkrkvplsecqlraqqwavpyvetsaktrenvdkvffdlmreirsrk

Sequence, based on observed residues (ATOM records):

>d5cm9c_ c.37.1.0 (C:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
alhkvimvgsggvgksaltlqfmyrkkvvldgeevqidildtagqedyaairdnyfrsge
gflcvfsitddesfqatqefreqilrvkndesipfllvgnkckvplsecqlraqqwavpy
vetsaktrenvdkvffdlmreirsrk

Timeline for d5cm9c_:

• d5cm9c_ is new in SCOPe 2.05-stable
  
• d5cm9c_ appears in SCOPe 2.06
  
• d5cm9c_ appears in the current release, SCOPe 2.08