![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
![]() | Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) ![]() |
![]() | Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins) automatically mapped to Pfam PF00194 |
![]() | Protein automated matches [190681] (2 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [280270] (4 PDB entries) |
![]() | Domain d4cnwa_: 4cnw A: [280274] automated match to d1v9ic_ complexed with ca, zn |
PDB Entry: 4cnw (more details), 2.03 Å
SCOPe Domain Sequences for d4cnwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cnwa_ b.74.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]} hwgydkhngpehwhkdfpiadgerqspvdidtdavdqdpalkplaldygeatsdrmvndg hsfnveyddsedkavlkdgpltgtyrlvqfhfhwgssddqgsehtvdrkkyaaelhlvhw ntkygdfgtaaqepdglavvgvflkvgdanpalqkvldaldsiktegkstdfpnfdpgsl lpnvldywtypgslttppllesvtwivlkepisvssqqmlkfrtlnfnaegepeelmlan wrpaqplkdrqvrgfpk
Timeline for d4cnwa_: