Lineage for d4cnxa_ (4cnx A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2420906Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2420907Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2420908Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 2422112Protein automated matches [190681] (2 species)
    not a true protein
  7. 2422113Species Cow (Bos taurus) [TaxId:9913] [280270] (4 PDB entries)
  8. 2422114Domain d4cnxa_: 4cnx A: [280273]
    automated match to d1v9ic_
    complexed with peg, zn

Details for d4cnxa_

PDB Entry: 4cnx (more details), 1.23 Å

PDB Description: surface residue engineering of bovine carbonic anhydrase to an extreme halophilic enzyme for potential application in postcombustion co2 capture
PDB Compounds: (A:) Carbonic anhydrase 2

SCOPe Domain Sequences for d4cnxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cnxa_ b.74.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
hwgydkhngpehwhedfpiadgerqspvdidtdavdqdpalkplaldygeatsdrmvndg
hsfnveyddsedkavlkdgpldgtyrlvqfhfhwgssddqgsehtvdrkkyaaelhlvhw
ntkygdfgtaaqepdglavvgvflkvgdanpalqkvldaldsiktegkstdfpdfdpgsl
lpevldywtypgslttppllesvtwivlkepisvsseqmlkfrtlnfnaegepeelmlan
wrpaqplkdrevrgfpk

SCOPe Domain Coordinates for d4cnxa_:

Click to download the PDB-style file with coordinates for d4cnxa_.
(The format of our PDB-style files is described here.)

Timeline for d4cnxa_: