SCOPe 2.05: Domain d4cnxa_: 4cnx A:

Lineage for d4cnxa_ (4cnx A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein automated matches [190681] (2 species)
   not a true protein

7. Species Bos taurus [TaxId:9913] [280270] (4 PDB entries)

8. Domain d4cnxa_: 4cnx A: [280273]
   automated match to d1v9ic_
   complexed with peg, zn

Details for d4cnxa_

PDB Entry: 4cnx, 1.23 Å

PDB Description: surface residue engineering of bovine carbonic anhydrase to an extreme halophilic enzyme for potential application in postcombustion co2 capture

PDB Compounds: (A:) Carbonic anhydrase 2

SCOPe Domain Sequences for d4cnxa_:

Sequence; same for both SEQRES and ATOM records:

>d4cnxa_ b.74.1.1 (A:) automated matches {Bos taurus [TaxId: 9913]}
hwgydkhngpehwhedfpiadgerqspvdidtdavdqdpalkplaldygeatsdrmvndg
hsfnveyddsedkavlkdgpldgtyrlvqfhfhwgssddqgsehtvdrkkyaaelhlvhw
ntkygdfgtaaqepdglavvgvflkvgdanpalqkvldaldsiktegkstdfpdfdpgsl
lpevldywtypgslttppllesvtwivlkepisvsseqmlkfrtlnfnaegepeelmlan
wrpaqplkdrevrgfpk

Timeline for d4cnxa_:

• d4cnxa_ is new in SCOPe 2.05-stable
  
• d4cnxa_ appears in SCOPe 2.06
  
• d4cnxa_ appears in the current release, SCOPe 2.08