SCOPe 2.06: Domain d4cnwb_: 4cnw B:

Lineage for d4cnwb_ (4cnw B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein automated matches [190681] (2 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [280270] (4 PDB entries)

8. Domain d4cnwb_: 4cnw B: [280272]
   automated match to d1v9ic_
   complexed with ca, zn

Details for d4cnwb_

PDB Entry: 4cnw, 2.03 Å

PDB Description: surface residue engineering of bovine carbonic anhydrase to an extreme halophilic enzyme for potential application in postcombustion co2 capture

PDB Compounds: (B:) Carbonic anhydrase 2

SCOPe Domain Sequences for d4cnwb_:

Sequence; same for both SEQRES and ATOM records:

>d4cnwb_ b.74.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
hhwgydkhngpehwhkdfpiadgerqspvdidtdavdqdpalkplaldygeatsdrmvnd
ghsfnveyddsedkavlkdgpltgtyrlvqfhfhwgssddqgsehtvdrkkyaaelhlvh
wntkygdfgtaaqepdglavvgvflkvgdanpalqkvldaldsiktegkstdfpnfdpgs
llpnvldywtypgslttppllesvtwivlkepisvssqqmlkfrtlnfnaegepeelmla
nwrpaqplkdrqvrgfpk

Timeline for d4cnwb_:

• d4cnwb_ first appeared in SCOPe 2.05
  
• d4cnwb_ appears in SCOPe 2.07
  
• d4cnwb_ appears in the current release, SCOPe 2.08