Class b: All beta proteins [48724] (180 folds) |
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) |
Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins) automatically mapped to Pfam PF00194 |
Protein automated matches [190681] (2 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [280270] (4 PDB entries) |
Domain d4cnwb_: 4cnw B: [280272] automated match to d1v9ic_ complexed with ca, zn |
PDB Entry: 4cnw (more details), 2.03 Å
SCOPe Domain Sequences for d4cnwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cnwb_ b.74.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]} hhwgydkhngpehwhkdfpiadgerqspvdidtdavdqdpalkplaldygeatsdrmvnd ghsfnveyddsedkavlkdgpltgtyrlvqfhfhwgssddqgsehtvdrkkyaaelhlvh wntkygdfgtaaqepdglavvgvflkvgdanpalqkvldaldsiktegkstdfpnfdpgs llpnvldywtypgslttppllesvtwivlkepisvssqqmlkfrtlnfnaegepeelmla nwrpaqplkdrqvrgfpk
Timeline for d4cnwb_: